FAM47A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FA47A

Key Reference: N/A

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: RQLLKLDSERKLEDARAPCEGREKTTDEPTEPGKYPCGKFCPRPFETPLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein FAM47A

Protein Size: 791

Purification: Affinity purified

• Artikelnummer: AVIARP53496_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53496_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 158724
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin