FAM47A Antibody - N-terminal region : HRP

FAM47A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53496_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FA47A

Key Reference: N/A

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: RQLLKLDSERKLEDARAPCEGREKTTDEPTEPGKYPCGKFCPRPFETPLS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: protein FAM47A

Protein Size: 791

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP53496_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53496_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 158724
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×