FAM50B Antibody - N-terminal region : Biotin

FAM50B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54850_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of FAM50B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM50B

Key Reference: Sedlacek,Z., (1999) Genomics 61 (2), 125-132

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM50B

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54850_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54850_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26240
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×