FAM78A Antibody - C-terminal region : Biotin

FAM78A Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55411_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact functions of FAM78A remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM78A

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNAN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM78A

Protein Size: 283

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55411_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55411_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286336
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×