FAM78A Antibody - N-terminal region : HRP

FAM78A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55410_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of FAM78A remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM78A

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM78A

Protein Size: 283

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55410_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55410_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 286336
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×