FAM79B Antibody - N-terminal region : HRP

FAM79B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55877_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM79B

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor protein p63-regulated gene 1 protein

Protein Size: 275

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55877_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55877_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285386
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×