FAM80A Antibody - middle region : FITC

FAM80A Antibody - middle region : FITC
Artikelnummer
AVIARP55677_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FAM80A is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM80A

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acetylaspartyl-glutamate synthetase A

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55677_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55677_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284716
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×