FAM83B Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of FAM83B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM83B

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 115kDa

Peptide Sequence: Synthetic peptide located within the following region: PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM83B

Protein Size: 1011

Purification: Affinity Purified

• Artikelnummer: AVIARP54399_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54399_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 222584
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin