FAM83B Antibody - C-terminal region : HRP

FAM83B Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54399_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of FAM83B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM83B

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 115kDa

Peptide Sequence: Synthetic peptide located within the following region: PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM83B

Protein Size: 1011

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54399_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54399_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222584
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×