FAM90A1 Antibody - N-terminal region : Biotin

FAM90A1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57109_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 [PubMed 17684299]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM90A1

Key Reference: 0

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM90A1

Protein Size: 464

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57109_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57109_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55138
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×