FAM92B Antibody - N-terminal region : FITC

FAM92B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55881_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM92B

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM92B

Protein Size: 304

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55881_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55881_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 339145
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×