FAM98B Antibody - N-terminal region : HRP

FAM98B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55663_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FAM98B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM98B

Key Reference: Tsuritani,K., (2007) Genome Res. 17 (7), 1005-1014

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM98B Ensembl ENSP00000380734

Protein Size: 433

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55663_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55663_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283742
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×