FASTKD2 Antibody - middle region : FITC

FASTKD2 Antibody - middle region : FITC
Artikelnummer
AVIARP55108_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FASTKD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FAST kinase domain-containing protein 2

Protein Size: 710

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55108_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55108_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22868
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×