FBXO10 Antibody - C-terminal region : FITC

FBXO10 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54858_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBX10

Key Reference: N/A

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box only protein 10

Protein Size: 956

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54858_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54858_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26267
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×