Fbxw4 Antibody - C-terminal region : FITC

Fbxw4 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57578_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of Fbxw4 remains unknow.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box and WD-40 domain protein 4 (Predicted) EMBL EDL94311.1

Protein Size: 408

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57578_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57578_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 309444
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×