Fbxw4 Antibody - C-terminal region : HRP

Fbxw4 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57578_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of Fbxw4 remains unknow.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: F-box and WD-40 domain protein 4 (Predicted) EMBL EDL94311.1

Protein Size: 408

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57578_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57578_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 309444
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×