FBXW4 Antibody - N-terminal region : FITC

FBXW4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57577_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human FBXW4

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: RQMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box/WD repeat-containing protein 4

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57577_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57577_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6468
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×