FBXW8 Antibody - middle region : FITC

FBXW8 Antibody - middle region : FITC
Artikelnummer
AVIARP55586_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXW8

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: RNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box/WD repeat-containing protein 8

Protein Size: 598

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55586_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55586_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26259
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×