FDXR Antibody - N-terminal region : FITC

FDXR Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54706_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: DHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial

Protein Size: 491

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54706_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54706_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2232
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×