FEM1B Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FEM1B

Key Reference: Kamura,T., (2004) Genes Dev. 18 (24), 3055-3065

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein fem-1 homolog B

Protein Size: 627

Purification: Affinity Purified

• Artikelnummer: AVIARP53703_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53703_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10116
• Wirt: Rabbit
• Konjugat: Conjugated, FITC