FEM1B Antibody - middle region : Biotin

FEM1B Antibody - middle region : Biotin
Artikelnummer
AVIARP53702_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FEM1B

Key Reference: Kamura,T., (2004) Genes Dev. 18 (24), 3055-3065

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein fem-1 homolog B

Protein Size: 627

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53702_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53702_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10116
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×