Fem1c Antibody - C-terminal region : HRP

Fem1c Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57364_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fem1c

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fem-1 homolog c (C.elegans) (Predicted) EMBL EDM14387.1

Protein Size: 617

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57364_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57364_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 302288
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×