FEV Antibody - N-terminal region : FITC

FEV Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57889_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repressor. This gene is exclusively expressed in neurons of the central serotonin (5-HT) system, a system implicated in the pathogeny of such psychiatric diseases as depression, anxiety, and eating disorders. In some types of Ewing tumors, this gene is fused to the Ewing sarcoma (EWS) gene following chromosome translocations.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FEV

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FEV

Protein Size: 238

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57889_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57889_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54738
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×