FITM1 Antibody - middle region : HRP

FITM1 Antibody - middle region : HRP
Artikelnummer
AVIARP53493_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 BX347190.2 448-541 c 95-825 BI114004.1 1-731 826-928 BQ574746.1 1-103 c

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC161247

Key Reference: Kadereit,B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 94-99

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fat storage-inducing transmembrane protein 1

Protein Size: 292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53493_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53493_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 161247
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×