FKBPL Antibody - N-terminal region : Biotin

FKBPL Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57597_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FKBPL

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FK506-binding protein-like

Protein Size: 349

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57597_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57597_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63943
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×