FLJ25791 Antibody - middle region : Biotin

FLJ25791 Antibody - middle region : Biotin
Artikelnummer
AVIARP55644_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ25791

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 310

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55644_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55644_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222521
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×