FLJ30934 Antibody - middle region : FITC

FLJ30934 Antibody - middle region : FITC
Artikelnummer
AVIARP55532_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ30934

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-32

Protein Size: 403

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55532_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55532_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 254122
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×