FLJ33790 Antibody - N-terminal region : FITC

FLJ33790 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54502_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific functin of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ33790

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 35

Protein Size: 363

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54502_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54502_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283212
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×