FLJ35767 Antibody - middle region : FITC

FLJ35767 Antibody - middle region : FITC
Artikelnummer
AVIARP56005_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ35767

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-expressed sequence 19 protein

Protein Size: 164

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56005_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56005_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 400629
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×