FNDC11 Antibody - C-terminal region : HRP

FNDC11 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53764_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C20orf195

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: FDRKASAAHQDWARLRWFVTIQPATSEQYELRFRLLDPRTQQECAQCGVI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: fibronectin type III domain-containing protein 11

Protein Size: 318

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53764_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53764_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79025
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×