FNDC11 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf195

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: fibronectin type III domain-containing protein 11

Protein Size: 318

Purification: Affinity Purified

• Artikelnummer: AVIARP53763_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53763_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79025
• Wirt: Rabbit
• Konjugat: Conjugated, FITC