FNDC8 Antibody - N-terminal region : FITC

FNDC8 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56975_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of FNDC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FNDC8

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibronectin type III domain-containing protein 8

Protein Size: 324

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56975_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56975_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54752
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×