Anti-CDADC1

cytidine and dCMP deaminase domain containing 1, Polyclonal, IgG, Rabbit

GeneName: CDADC1

Concentration: 0,1

Sequence: LWMELFPAEAQRQKSQKNEEGKHGPLGDNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKMIVN

InterspeciesReactivity: ENSMUSG00000021982: 87%, ENSRNOG00000012209: 86%

Entrez Gene ID: 81602

Uniprot ID: Q9BWV3

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal CDADC1 Antibody against Human cytidine and dCMP deaminase domain containing 1. Validated for Western Blot

• Artikelnummer: ATLHPA058766-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA058766-25
• Verpackungseinheit: 25UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 81602
• Wirt: Rabbit
• Konjugat: Unconjugated