Anti-RABEPK

Rab9 effector protein with kelch motifs, Polyclonal, IgG, Rabbit

GeneName: RABEPK

Concentration: 0,05

Sequence: CIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD

InterspeciesReactivity: ENSMUSG00000070953: 62%, ENSRNOG00000018591: 65%

Entrez Gene ID: 10244

Uniprot ID: Q7Z6M1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal RABEPK Antibody against Human Rab9 effector protein with kelch motifs. Validated for Western Blot

• Artikelnummer: ATLHPA022471-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA022471-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 10244
• Wirt: Rabbit
• Konjugat: Unconjugated