Anti-SNF8

SNF8 subunit of ESCRT-II, Polyclonal, IgG, Rabbit

GeneName: SNF8

Concentration: 0,1

Sequence: WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL

InterspeciesReactivity: ENSMUSG00000006058: 100%, ENSRNOG00000006500: 100%

Entrez Gene ID: 11267

Uniprot ID: Q96H20

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SNF8 Antibody against Human SNF8 subunit of ESCRT-II. Validated for Western Blot

• Artikelnummer: ATLHPA021228-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA021228-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 11267
• Wirt: Rabbit
• Konjugat: Unconjugated