PrEST Antigen ANKS4B

ankyrin repeat and sterile alpha motif domain containing 4B

Sequence: TFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEEDSFSGDFKEKLQLSAEEDGSVHHESILNRPGLG

GeneName: ANKS4B

Ensembl Gene ID: ENSG00000175311

UniProt ID: Q8N8V4

Entrez Gene ID: 257629

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000046181: 78%, ENSMUSG00000030909: 81%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST94815-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST94815-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 257629
• Konjugat: Unconjugated