PrEST Antigen C1GALT1C1

C1GALT1 specific chaperone 1

Sequence: SQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMY

GeneName: C1GALT1C1

Ensembl Gene ID: ENSG00000171155

UniProt ID: Q96EU7

Entrez Gene ID: 29071

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000048970: 92%, ENSRNOG00000002536: 91%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST94534-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST94534-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 29071
• Konjugat: Unconjugated