PrEST Antigen CCDC82

coiled-coil domain containing 82
Artikelnummer
ATLAPREST95044-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: DEEGDEENKNQQGEKLTTSQLKLVKRNSLYSFSDHYTHFERVVKALLINALDESFLGTLYDGTRQKSYAKDMLTSLHYLDNRFVQP

GeneName: CCDC82

Ensembl Gene ID: ENSG00000149231

UniProt ID: Q8N4S0

Entrez Gene ID: 79780

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000005713: 85%, ENSMUSG00000079084: 88%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST95044-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95044-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 79780
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download