PrEST Antigen CD109

CD109 molecule

Sequence: VVSGNKRLKELSYMVVSRGQLVAVGKQNSTMFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHEL

GeneName: CD109

Ensembl Gene ID: ENSG00000156535

UniProt ID: Q6YHK3

Entrez Gene ID: 135228

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000025332: 77%, ENSMUSG00000046186: 72%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST71509
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APREST71509-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 135228
• Konjugat: Unconjugated