PrEST Antigen CFAP161

cilia and flagella associated protein 161

Sequence: RIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEI

GeneName: CFAP161

Ensembl Gene ID: ENSG00000156206

UniProt ID: Q6P656

Entrez Gene ID: 161502

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000012301: 74%, ENSMUSG00000011154: 73%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST95439-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95439-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 161502
• Konjugat: Unconjugated