PrEST Antigen DGCR8

DGCR8 microprocessor complex subunit
Artikelnummer
ATLAPREST73361
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: YGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDAL

GeneName: DGCR8

Ensembl Gene ID: ENSG00000128191

UniProt ID: Q8WYQ5

Entrez Gene ID: 54487

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000001886: 93%, ENSMUSG00000106687: 95%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST73361
Hersteller Atlas Antibodies
Hersteller Artikelnummer APREST73361-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 54487
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download