PrEST Antigen DNAH6

dynein axonemal heavy chain 6

Sequence: NANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLG

GeneName: DNAH6

Ensembl Gene ID: ENSG00000115423

UniProt ID: Q9C0G6

Entrez Gene ID: 1768

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000052861: 90%, ENSRNOG00000015581: 89%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST94821-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST94821-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 1768
• Konjugat: Unconjugated