PrEST Antigen F2RL3

F2R like thrombin or trypsin receptor 3
Artikelnummer
ATLAPREST94658-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ

GeneName: F2RL3

Ensembl Gene ID: ENSG00000127533

UniProt ID: Q96RI0

Entrez Gene ID: 9002

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000048186: 48%, ENSMUSG00000050147: 52%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST94658-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST94658-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 9002
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download