PrEST Antigen GADD45GIP1

GADD45G interacting protein 1
Artikelnummer
ATLAPREST95097-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: WPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPE

GeneName: GADD45GIP1

Ensembl Gene ID: ENSG00000179271

UniProt ID: Q8TAE8

Entrez Gene ID: 90480

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000033751: 76%, ENSRNOG00000003011: 76%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST95097-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95097-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 90480
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download