PrEST Antigen MXI1

MAX interactor 1, dimerization protein
Artikelnummer
ATLAPREST94630-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: RERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGP

GeneName: MXI1

Ensembl Gene ID: ENSG00000119950

UniProt ID: P50539

Entrez Gene ID: 4601

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000025025: 100%, ENSRNOG00000034078: 100%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST94630-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST94630-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 4601
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download