PrEST Antigen N4BP2L1

NEDD4 binding protein 2 like 1

Sequence: SGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQ

GeneName: N4BP2L1

Ensembl Gene ID: ENSG00000139597

UniProt ID: Q5TBK1

Entrez Gene ID: 90634

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000041132: 90%, ENSRNOG00000059322: 92%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST95951-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95951-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 90634
• Konjugat: Unconjugated