PrEST Antigen NAA50

N(alpha)-acetyltransferase 50, NatE catalytic subunit

Sequence: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF

GeneName: NAA50

Ensembl Gene ID: ENSG00000121579

UniProt ID: Q9GZZ1

Entrez Gene ID: 80218

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPREST95241-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95241-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 80218
• Konjugat: Unconjugated