PrEST Antigen POU5F2

POU domain class 5, transcription factor 2
Artikelnummer
ATLAPREST95472-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP

GeneName: POU5F2

Ensembl Gene ID: ENSG00000248483

UniProt ID: Q8N7G0

Entrez Gene ID: 134187

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000062285: 74%, ENSMUSG00000093668: 73%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST95472-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95472-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 134187
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download