PrEST Antigen PPP3CC

protein phosphatase 3 catalytic subunit gamma
Artikelnummer
ATLAPrEST95711-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN

GeneName: PPP3CC

Ensembl Gene ID: ENSG00000120910

UniProt ID: P48454

Entrez Gene ID: 5533

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000009745: 97%, ENSMUSG00000021816: 97%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPrEST95711-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95711-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 5533
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download