PrEST Antigen RRP12

ribosomal RNA processing 12 homolog
Artikelnummer
ATLAPREST95239-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ

GeneName: RRP12

Ensembl Gene ID: ENSG00000052749

UniProt ID: Q5JTH9

Entrez Gene ID: 23223

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000048495: 88%, ENSMUSG00000035049: 90%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPREST95239-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST95239-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 23223
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download